DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tmprss6

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:257 Identity:89/257 - (34%)
Similarity:135/257 - (52%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV-IGTVASQ-- 96
            |..|||||..:...:.|:|.||:.:|        ||.|||::..:..::|||||. ..::||.  
  Rat   573 PSSRIVGGAMSSEGEWPWQASLQIRG--------RHICGGALIADRWVITAAHCFQEDSMASPRL 629

  Fly    97 YKVVAGTNFQTGS-DGVIT-NVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALE 159
            :.|..|...|... .|.:: .|..:.:|. |:...:::.|:|:|.:|.|: :.:.|::.:.|...
  Rat   630 WTVFLGKMRQNSRWPGEVSFKVSRLFLHP-YHEEDSHDYDVALLQLDHPV-VYSATVRPVCLPAR 692

  Fly   160 ----QPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAG 220
                :|  |....::|||....||..|:.|..|||.::..:||::.|.      |::|..|||||
  Rat   693 SHFFEP--GQHCWITGWGAQREGGPGSSTLQKVDVQLIPQDLCNEAYR------YQVTPRMLCAG 749

  Fly   221 KRGVGGADACQGDSGGPLAVRDE-----LYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVL 277
            .| .|..|||||||||||..::.     |.|:||||..|..||:.|||..|..:..||..||
  Rat   750 YR-KGKKDACQGDSGGPLVCKEPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVVNWIQQVL 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/248 (34%)
Tryp_SPc 39..276 CDD:238113 85/250 (34%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 84/248 (34%)
Tryp_SPc 577..809 CDD:238113 85/250 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.