DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG6048

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:286 Identity:105/286 - (36%)
Similarity:146/286 - (51%) Gaps:29/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGL---PLLEDLDEKSV------PDGRIVGGYATDIAQVPYQISLRYKGITTP 64
            |||..:.|:.|..||   .....||.|::      ..|||:.|....:....:|:.:| |.:.  
  Fly     7 LLAVALLLIFLPSGLRGATTRTHLDTKAIRPRFNADPGRIINGTEASLGATRHQVGIR-KALN-- 68

  Fly    65 ENPF---RHRCGGSIFNETTIVTAAHCVI------GTVA--SQYKVVAGTNFQTGSDGVIT-NVK 117
            :..|   .|.||||:.....::|||||.:      ||..  .::.||.|...:......:| .::
  Fly    69 DGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPKEEFIVVMGNLDRYNRTNTLTFTIE 133

  Fly   118 EIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSS 182
            |.:|....:..:.|:.|||:|.::..:|..:.||:.|.|......||.|.:|:|||.|. .||.|
  Fly   134 ERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPTIRPIALNRFAIPEGVVCQVTGWGNTE-DGYVS 197

  Fly   183 NQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGV 247
            :.|:.||||::|.|.|..| .|.|   :.|...|:|||...||..|||.|||||||..:.||.||
  Fly   198 DILMTVDVPMISEEHCIND-SDLG---HLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSELAGV 258

  Fly   248 VSWGNSCALPNYPGVYANVAYLRPWI 273
            ||||..||||..||||..|:|...||
  Fly   259 VSWGIQCALPRLPGVYTEVSYYYDWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 92/246 (37%)
Tryp_SPc 39..276 CDD:238113 93/247 (38%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 92/246 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.