DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tmprss9

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:251 Identity:86/251 - (34%)
Similarity:125/251 - (49%) Gaps:30/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PDG---RIVGGYATDIAQVPYQIS--LRYKGITTPENPFRHRCGGSIFNETTIVTAAHC--VIGT 92
            |.|   |||||.|..:.:.|:|:|  ||.:         .||||..:..|..:::||||  |.|.
  Rat   857 PPGALTRIVGGSAASLGEWPWQVSLWLRRR---------EHRCGAVLVAERWLLSAAHCFDVYGD 912

  Fly    93 VASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLA 157
             ..|:....||.|.:.::|.:..|..|..|. :|:....:.|:|:|.:..|:..:..........
  Rat   913 -PMQWAAFLGTPFLSSTEGQLERVARIYRHP-FYNIYTLDYDVALLELAGPVRRSRLVRPICLPG 975

  Fly   158 LEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKR 222
            ..:|.||....::|||:...||..:.||....|.::|.:.|.:.|      ..:|:|.||||| .
  Rat   976 PTRPPEGARCVITGWGSLREGGSMARQLQKAAVRVLSEQTCRRFY------PVQISSRMLCAG-F 1033

  Fly   223 GVGGADACQGDSGGPLAVRDE-----LYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            ..||.|:|.||:|||||.|:.     |.||.|||..|..|::||||..||.:..||
  Rat  1034 PQGGVDSCSGDAGGPLACREPSGQWVLTGVTSWGYGCGRPHFPGVYTRVAAVLGWI 1089

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 82/243 (34%)
Tryp_SPc 39..276 CDD:238113 83/244 (34%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.