DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prtn3

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:252 Identity:69/252 - (27%)
Similarity:103/252 - (40%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQY 97
            :|...:||||:.......||..||:..     .:|..|.|||::.:...::|||||:........
  Rat   192 AVQASKIVGGHEARPHSRPYVASLQLS-----RSPGSHFCGGTLIHPRFVLTAAHCLQDISWQLV 251

  Fly    98 KVVAGTNFQTGSDG-----VITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLA 157
            .||.|.:....|:.     .||.|     .|..|:.....||:.:|.::.|..|......|....
  Rat   252 TVVLGAHDLLSSEPEQQKFTITQV-----FENNYNPEETLNDVLLLQLNRPASLGKQVAVASLPQ 311

  Fly   158 LEQPI-EGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGK 221
            .:|.: :||.....|||.......:...|..::|.:|: .||            |..:......:
  Rat   312 QDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVVT-FLC------------REHNVCTLVPR 363

  Fly   222 RGVGGADACQGDSGGPLAVRDELYGVVSWG-NSCALPNYPGVYANVAYLRPWIDAVL 277
            |..|   .|.|||||||.....|:||.|:. ..||...:|..:|.|:....||.:||
  Rat   364 RAAG---ICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHSVL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 64/241 (27%)
Tryp_SPc 39..276 CDD:238113 66/243 (27%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.