DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG3795

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:246 Identity:79/246 - (32%)
Similarity:120/246 - (48%) Gaps:24/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IVGGYATDIAQ-VPYQISLRYKGITTPENPF--RHRCGGSIFNETTIVTAAHCVIGT----VASQ 96
            :.|||..|... |.|.:|||   :..|:..|  .|.|.|:||:|..|:|||||:...    .|.:
  Fly    46 VTGGYRPDTNDLVKYTVSLR---MGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKK 107

  Fly    97 YKVVAGT--NFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALE 159
            ..|||||  .....|...|...:|::.|..|..|.:...||.::.::..|.|.:...| |.|..:
  Fly   108 LMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAK-IPLYNK 171

  Fly   160 QPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQ--DYEDFGDETYRITSAMLCAGKR 222
            .|:.|....:.||||....|...::.:..|:.|:.:..|::  .:.:.|         ||||..:
  Fly   172 VPVAGAPCSIVGWGTVIQFGPLPDEAINGDMQILPDTFCEKLLGWSNAG---------MLCANDK 227

  Fly   223 GVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            .....|:|||||||||...:.:.|:||:|..|..|:..|:|.:|.:.|.||
  Fly   228 HDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 77/244 (32%)
Tryp_SPc 39..276 CDD:238113 79/246 (32%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 74/232 (32%)
Tryp_SPc 60..278 CDD:214473 72/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.