DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG11664

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:242 Identity:55/242 - (22%)
Similarity:84/242 - (34%) Gaps:86/242 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGY------------- 125
            ||:|:...::|.|||                |:..     |..:|:.:..||             
  Fly    49 GSLFSARYVLTVAHC----------------FKKN-----TKPEELSVRAGYRWIAWEFRGKQVA 92

  Fly   126 -------YSGAAYNNDIAILFVD-----------------PPLPLNNFTIKAIKLALEQPIEGTV 166
                   :|.....||||:|.|.                 |..|||.|.         .|.|   
  Fly    93 GLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFA---------PPQE--- 145

  Fly   167 SKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQ 231
              ::||...    :.:..|.::.|.:...:.|.|.:.       :|:..::||.  ...|...|.
  Fly   146 --LAGWNLM----HIAQPLKSMSVQVEPEKNCRQWFP-------QISGGVICAS--ATMGEGLCY 195

  Fly   232 GDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWI-DAVL 277
            ||||.||....|:.|:......|....||.::.:|.|.|.:| .|||
  Fly   196 GDSGDPLISGGEVCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQAVL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 51/235 (22%)
Tryp_SPc 39..276 CDD:238113 52/239 (22%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 52/237 (22%)
Tryp_SPc 38..237 CDD:214473 51/235 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.