DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss30

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:252 Identity:92/252 - (36%)
Similarity:121/252 - (48%) Gaps:19/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTV-ASQYKVV 100
            |:||||......|.|:|:||   .||..    .|.||||:.:|..::|||||...:: .|.|.|.
Mouse    72 GKIVGGQDALEGQWPWQVSL---WITED----GHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVK 129

  Fly   101 AG--TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIE 163
            .|  |.........:..|:.|.:|..|....|.:.|||::.:|.||..:.||...:..|......
Mouse   130 VGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFTPVCLPAAQTPLTP 194

  Fly   164 GTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYR---ITSAMLCAGKRGVG 225
            |||..|:|||.|.....:| .|..:.||::.:|.|::.|...|.....   |.|.||||| ...|
Mouse   195 GTVCWVTGWGATQERDMAS-VLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAG-YVEG 257

  Fly   226 GADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVLA 278
            ..|:|||||||||.....    ..|:.|||..||.|..||||..|.....||..:||
Mouse   258 QKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 87/244 (36%)
Tryp_SPc 39..276 CDD:238113 89/246 (36%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 89/246 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.