DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk12

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:240 Identity:80/240 - (33%)
Similarity:116/240 - (48%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 YKGITTPEN--PFR----H----RCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGV 112
            |.|:...:|  |::    |    ||||.:.:...::|||||     :.:|.|..|.:..:..|  
  Rat    23 YNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHC-----SGKYMVRLGEHSLSKLD-- 80

  Fly   113 ITNVKEI----VMHEGYYSGAAYNN---DIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVS 170
            :|....:    :.|..|:  .||.|   |:.:|.::.|:.| .:.::.:.|.......|....:|
  Rat    81 LTEQLRLTTFSITHPSYH--GAYQNHEHDLRLLRLNRPISL-TYAVRPVALPSSCAPTGAKCHIS 142

  Fly   171 GWGTTS-PGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDS 234
            |||||: |.....::|..:|:.|||||.|...:..      |:|..|||||  |..|.|||||||
  Rat   143 GWGTTNKPWDPFPDRLQCLDLSIVSNETCRAVFPG------RVTENMLCAG--GEAGKDACQGDS 199

  Fly   235 GGPLAVRDELYGVVSWGN--SCALPNYPGVYANVAYLRPWIDAVL 277
            ||||.....|.|:||||:  .|.....||||..|.....||..|:
  Rat   200 GGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWIRVVI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 77/234 (33%)
Tryp_SPc 39..276 CDD:238113 79/237 (33%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.