DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tmprss11e

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:253 Identity:92/253 - (36%)
Similarity:128/253 - (50%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV-IGTVASQYKVVA 101
            |||||.:.:..:.|:|.||::.|        .||||.::.:.|.:|:||||. .....|::....
  Rat   212 RIVGGTSAEEGEWPWQSSLQWDG--------SHRCGATLISNTWLVSAAHCFRTHKDPSRWTASF 268

  Fly   102 GTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAI-KLALE------ 159
            |...|...  :.|.::.|::|| .|:..:::.|||::.:..|:|..|    |: |:.|.      
  Rat   269 GATLQPPK--LTTGIRRIIVHE-KYNYPSHDYDIALVELSRPVPCTN----AVHKVCLPDANHEF 326

  Fly   160 QPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD--QDYEDFGDETYRITSAMLCAG-- 220
            ||  |....|:|:|.....|::.|.|..|.|..:..:.|:  |.|..      .||..|||||  
  Rat   327 QP--GQRMFVTGFGALRNDGFAQNYLRQVQVDYIDTQTCNRPQSYNG------AITPRMLCAGFL 383

  Fly   221 KRGVGGADACQGDSGGPLA---VRDELY--GVVSWGNSCALPNYPGVYANVAYLRPWI 273
            |   |..|||||||||||.   |||..|  ||||||:.|..||.||||..|...|.||
  Rat   384 K---GEKDACQGDSGGPLVTPDVRDVWYLAGVVSWGDECGQPNKPGVYTRVTAFRDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 90/251 (36%)
Tryp_SPc 39..276 CDD:238113 91/252 (36%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 91/252 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.