DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and GZMH

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:290 Identity:75/290 - (25%)
Similarity:121/290 - (41%) Gaps:68/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCG 73
            |||||::..|.|:                .|:||:.......||...:::.     :...|.|||
Human     7 LLAFLLTPGAGTE----------------EIIGGHEAKPHSRPYMAFVQFL-----QEKSRKRCG 50

  Fly    74 GSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGY-----------YS 127
            |.:..:..::|||||    ..|...|..|.:          |:||....:.:           |:
Human    51 GILVRKDFVLTAAHC----QGSSINVTLGAH----------NIKEQERTQQFIPVKRPIPHPAYN 101

  Fly   128 GAAYNNDIAILFVDPPLPLNNFTIKAIKL--ALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAV-- 188
            ...::|||.:|.::....... .::.::|  :..|...|.:..|:||      ||.|...||.  
Human   102 PKNFSNDIMLLQLERKAKWTT-AVRPLRLPSSKAQVKPGQLCSVAGW------GYVSMSTLATTL 159

  Fly   189 -DVPIVSNELCDQDYEDFGDETYRITSAMLCAG--KRGVGGADACQGDSGGPLAVRDELYGVVSW 250
             :|.:...:.|..:....|:.: |.|.  :|.|  |:...|   .:|||||||..:|...|::|:
Human   160 QEVLLTVQKDCQCERLFHGNYS-RATE--ICVGDPKKTQTG---FKGDSGGPLVCKDVAQGILSY 218

  Fly   251 GNSCALPNYPGVYANVAYLRPWIDAVLAGL 280
            ||....|  ||||..|::..|||...:..|
Human   219 GNKKGTP--PGVYIKVSHFLPWIKRTMKRL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 65/252 (26%)
Tryp_SPc 39..276 CDD:238113 67/254 (26%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 67/254 (26%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.