DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Elane

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:278 Identity:71/278 - (25%)
Similarity:111/278 - (39%) Gaps:55/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCG 73
            |||.|:...||.                ..||||........|:.:||:.:|        .|.||
  Rat    19 LLALLLVCPALA----------------SEIVGGRPAQPHAWPFMVSLQRRG--------GHFCG 59

  Fly    74 GSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGV--ITNVKEIVMHEGYYSGAAYNNDIA 136
            .::.....:::|||||.|......:||.|.:.....:..  |.:|:.|  .|..:..:...|||.
  Rat    60 ATLIARNFVMSAAHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRI--FENGFDPSRLLNDIV 122

  Fly   137 ILFVDPPLPLNNFTIKAIKLALEQPIEG------TVSKVSGWGTTSPGGYSSNQLLAVDVPIVSN 195
            |:.::     .:.||.|.....|.|.:|      |.....|||.........:.|..::|.:|:|
  Rat   123 IIQLN-----GSATINANVQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVTN 182

  Fly   196 ELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSW-GNSCALPNY 259
             ||.:          |:....|...::    |..|.|||||||...:.:.|:.|: ...|....|
  Rat   183 -LCRR----------RVNVCTLVPRRQ----AGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFY 232

  Fly   260 PGVYANVAYLRPWIDAVL 277
            |..:|.||....||::::
  Rat   233 PDAFAPVAEFADWINSII 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 63/243 (26%)
Tryp_SPc 39..276 CDD:238113 65/245 (27%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 63/243 (26%)
Tryp_SPc 33..249 CDD:238113 65/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.