DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk1c3

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:286 Identity:83/286 - (29%)
Similarity:134/286 - (46%) Gaps:57/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSI 76
            ||:..:||:.|     .:|.......|:|||:..:....|:|:::..:.:          |||.:
  Rat     3 FLILFLALSLG-----QIDAAPPGQSRVVGGFKCEKNSQPWQVAVINEDL----------CGGVL 52

  Fly    77 FNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSG------------- 128
            .:.:.::|||||    .:..|.|:.|.|          |:.|.|.|......             
  Rat    53 IDPSWVITAAHC----YSDNYHVLLGQN----------NLSEDVQHRLVSQSFRHPDYKPFLMRN 103

  Fly   129 -----AAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS-SNQLLA 187
                 ..|:||:.:|.:..|..:.: .:|.|.|..::|..|:...|||||:|:|..:. .:.|..
  Rat   104 HTRKPKDYSNDLMLLHLSEPADITD-GVKVIDLPTKEPKVGSTCLVSGWGSTNPSEWEFPDDLQC 167

  Fly   188 VDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGN 252
            |::.::|||.|.:.|::      ::|..|||||:. .||.|.|:|||||||.....|.|:.|||:
  Rat   168 VNIHLLSNEKCIKAYKE------KVTDLMLCAGEL-EGGKDTCRGDSGGPLICDGVLQGITSWGS 225

  Fly   253 -SCALPNYPGVYANVAYLRPWIDAVL 277
             .|..||.||:|..:.....||..|:
  Rat   226 VPCGEPNKPGIYTKLIKFTSWIKEVM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 74/254 (29%)
Tryp_SPc 39..276 CDD:238113 75/256 (29%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 74/254 (29%)
Tryp_SPc 25..250 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.