DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk1c8

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:289 Identity:86/289 - (29%)
Similarity:136/289 - (47%) Gaps:49/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDG--RIVGGYATDIAQVPYQISLRYKGITTPENP 67
            |:  |:.||:    |:.|.       ..:.|.|  ||:||:..:....|:|:::.:  ...|:  
  Rat     2 WL--LILFLI----LSLGW-------NDAAPPGQSRIIGGFNCEKNSQPWQVAVYH--FNEPQ-- 49

  Fly    68 FRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITN--VKEIVMHEGY----- 125
                |||.:.:.:.::|||||    .:..|:|..|.|.....:....:  |.:...|.|:     
  Rat    50 ----CGGVLIHPSWVITAAHC----YSVNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPGFNLDII 106

  Fly   126 -----YSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS-SNQ 184
                 ..|..|:||:.:|.:..|..:.: .:|.|.|..|:|..|:....||||:.:|..:. .:.
  Rat   107 KNHTRKPGNDYSNDLMLLHLKTPADITD-GVKVIDLPTEEPKVGSTCLTSGWGSITPLKWEFPDD 170

  Fly   185 LLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS 249
            |..|::.::|||.|.:.|.|      .:|..|||||:.. ||.|.|:|||||||.....|.|:.|
  Rat   171 LQCVNIHLLSNEKCIKAYND------EVTDVMLCAGEMD-GGKDICKGDSGGPLICDGVLQGITS 228

  Fly   250 WGN-SCALPNYPGVYANVAYLRPWIDAVL 277
            ||: .|..||.|.||..:.....||..|:
  Rat   229 WGSMPCGEPNKPSVYTKLIKFTSWIKKVM 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 75/248 (30%)
Tryp_SPc 39..276 CDD:238113 76/250 (30%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 75/248 (30%)
Tryp_SPc 25..256 CDD:238113 76/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.