DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk1c10

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:280 Identity:88/280 - (31%)
Similarity:133/280 - (47%) Gaps:41/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSI 76
            ||:..:||:.|     .:|.......||||||..:....|:|:::..:          :.|||.:
  Rat     3 FLILFLALSLG-----GIDAAPPGQSRIVGGYKCEKNSQPWQVAIINE----------YLCGGVL 52

  Fly    77 FNETTIVTAAHCVIGTVASQYKVVAGTN--FQTGSDGVITNVKEIVMHEGY----------YSGA 129
            .:.:.::|||||    .::.|.|:.|.|  |:.........|.:...|..|          ..|.
  Rat    53 IDPSWVITAAHC----YSNYYHVLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGD 113

  Fly   130 AYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS-SNQLLAVDVPIV 193
            .|:||:.:|.:..|..:.: .:|.|.|..|:|..|:....||||:|.|..:. .:.|..|::.::
  Rat   114 DYSNDLMLLHLSEPADITD-GVKVIDLPTEEPKVGSTCLASGWGSTKPLNWELPDDLQCVNIHLL 177

  Fly   194 SNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGN-SCALP 257
            |||.|.:.||.      ::|..|||||:.. |..|.|:|||||||.....|.|:.|||| .||.|
  Rat   178 SNEKCIEAYEQ------KVTDLMLCAGEMD-GRKDTCKGDSGGPLICDGVLQGITSWGNVPCAEP 235

  Fly   258 NYPGVYANVAYLRPWIDAVL 277
            ..||||..:.....||..|:
  Rat   236 YNPGVYTKLIKFTSWIKEVM 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 79/248 (32%)
Tryp_SPc 39..276 CDD:238113 80/250 (32%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 79/248 (32%)
Tryp_SPc 25..254 CDD:238113 80/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.