DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk7

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:274 Identity:92/274 - (33%)
Similarity:133/274 - (48%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFR 69
            |::.||..|:||...|.|            ...||:.||.......|:|::| .||       .:
  Rat     4 WLLSLLTVLLSLALETAG------------QGERIIDGYKCKEGSHPWQVAL-LKG-------DQ 48

  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNND 134
            ..|||.:..|:.::|||||.:|    ||.|..|::.................|.| ||...:.||
  Rat    49 LHCGGVLVGESWVLTAAHCKMG----QYTVHLGSDKIEDQSAQRIKASRSFRHPG-YSTRTHVND 108

  Fly   135 IAILFVDPPLPLNNFTIKAIKLA--LEQPIEGTVSKVSGWG-TTSPGGYSSNQLLAVDVPIVSNE 196
            |.::.:|.|:.::: .::.:||.  .|.|  ||:..||||| ||||.....:.|:..||.::|::
  Rat   109 IMLVKMDKPVKMSD-KVQKVKLPDHCEPP--GTLCTVSGWGTTTSPDVTFPSDLMCSDVKLISSQ 170

  Fly   197 LCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGN-SCALPNYP 260
            .|.:.|:|...:|      |||||... ...:.|.|||||||...|.|.|:||||. .|..||.|
  Rat   171 ECKKVYKDLLGKT------MLCAGIPD-SKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDP 228

  Fly   261 GVYANVAYLRPWID 274
            |||..|...:.|::
  Rat   229 GVYTQVCKYQRWLE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 83/238 (35%)
Tryp_SPc 39..276 CDD:238113 83/240 (35%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 83/237 (35%)
Tryp_SPc 26..244 CDD:238113 83/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.