DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk9

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:280 Identity:84/280 - (30%)
Similarity:124/280 - (44%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHR 71
            :||...|.||:|...|            .|.|.||.........|:|..|.|  :|      |..
  Rat     3 LGLTLVLFSLLAGHCG------------ADTRAVGARECQRNSQPWQAGLFY--LT------RQL 47

  Fly    72 CGGSIFNETTIVTAAHCVIGTVASQYK-VVAGTN--FQTGSDGVITNVKEIVMHEGY---YSGAA 130
            ||.::.|:..::|||||     ...|. |..|.:  :|......:..|.:...|.|:   .|...
  Rat    48 CGATLINDQWLLTAAHC-----RKPYLWVRLGEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSAND 107

  Fly   131 YNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSN-----QLLAVDV 190
            :|:||.::.:...:.|:. .::.:.|:...|..||...:||||:.|    ||.     .|...::
  Rat   108 HNDDIMLIRLPRKVRLSP-AVQPLNLSQSLPSVGTQCLISGWGSVS----SSKIQFPMTLQCANI 167

  Fly   191 PIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNS-C 254
            .|:.|:||...|..      .|:..||||| ...||..:|||||||||..:..|.|:||.|:. |
  Rat   168 SILDNKLCRWAYPG------HISEKMLCAG-LWEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPC 225

  Fly   255 ALPNYPGVYANVAYLRPWID 274
            :.|..|.||.:|.:...||:
  Rat   226 SRPQRPAVYTSVFHYLDWIE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 74/246 (30%)
Tryp_SPc 39..276 CDD:238113 75/248 (30%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.