DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk11

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:250 Identity:79/250 - (31%)
Similarity:114/250 - (45%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAG 102
            ||:.||.......|:|::|..|        .|..||.::.....::|||||    ....|.::.|
  Rat    50 RIIKGYECRPHSQPWQVALFQK--------TRLLCGATLIAPKWLLTAAHC----RKPHYVILLG 102

  Fly   103 TNFQTGSDGVITN--VKEIVMHEGYYSGAA---YNNDIAILFVDPPLPLNNFTIKAIK-LALEQ- 160
            .:....:||....  ..|...|.|:.:...   :.|||.::.:..|.    |..:|:: |.|.. 
  Rat   103 EHNLEKTDGCEQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMSSPA----FITRAVRPLTLSSL 163

  Fly   161 -PIEGTVSKVSGWGTT-SPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRG 223
             ...||...:|||||| ||.....:.|...:|.|:.::.|::.|..      .||..||||..| 
  Rat   164 CVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECERAYPG------NITDTMLCASVR- 221

  Fly   224 VGGADACQGDSGGPLAVRDELYGVVSWG-NSCALPNYPGVYANVAYLRPWIDAVL 277
            ..|.|:|||||||||.....|.|::||| :.||:...||||..|.....||..|:
  Rat   222 KEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDWIHEVM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/244 (31%)
Tryp_SPc 39..276 CDD:238113 77/246 (31%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 76/244 (31%)
Tryp_SPc 51..275 CDD:238113 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.