DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tpsb2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:254 Identity:91/254 - (35%)
Similarity:129/254 - (50%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQ--YKVVA 101
            ||||.....::.|:|:|||:|     .:.:.|.||||:.:...::||||||...:.|.  ::|..
  Rat    30 IVGGREASESKWPWQVSLRFK-----FSFWMHFCGGSLIHPQWVLTAAHCVGLHIKSPELFRVQL 89

  Fly   102 GTNFQTGSDGVITNVKEIVMHEGYYS---GAAYNNDIAILFVDPPLPLN-NFTIKAIKLALEQPI 162
            ...:...:|.::| |...|:|..||:   ||    |||:|.::.|:.:: :....::..|.|...
  Rat    90 REQYLYYADQLLT-VNRTVVHPHYYTVEDGA----DIALLELENPVNVSTHIHPTSLPPASETFP 149

  Fly   163 EGTVSKVSGWGTTSPGGYSSNQLL------AVDVPIVSNELCDQDYED---FGDETYRITSAMLC 218
            .||...|:|||...    |...||      .|.||||.|.|||:.|..   .||:...:...|||
  Rat   150 SGTSCWVTGWGDID----SDEPLLPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLC 210

  Fly   219 AGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            ||..   .:|:|||||||||..:.:    ..||||||..||..|.||:|..|.|...||
  Rat   211 AGNT---RSDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 89/252 (35%)
Tryp_SPc 39..276 CDD:238113 91/254 (36%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 91/254 (36%)
Tryp_SPc 30..266 CDD:214473 89/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.