DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Habp2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:282 Identity:93/282 - (32%)
Similarity:134/282 - (47%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PLLE----------DLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFN 78
            |::|          ::.|.:|.  ||.||:.:...:.|:|:||:.....|...|..|.||||:.:
  Rat   289 PVMELPGFDSCGKTEMTEHAVK--RIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGSLIH 351

  Fly    79 ETTIVTAAHCVIGTVASQYKVVAGTN--FQTGSDGVITNVKEIVMHEGYYS-GAAYNNDIAILFV 140
            ...::|||||. .......|||.|..  .:|.|......|::|:.:..|.. ....:||||:|.:
  Rat   352 PCWVLTAAHCT-DMSTKHLKVVLGDQDLKKTESHEQTFRVEKILKYSQYNERDEIPHNDIALLKL 415

  Fly   141 DP---PLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD--Q 200
            .|   ...|.:..:|.:.|..:....||...:||||.|.. |..|.|||...|.:::|.||:  |
  Rat   416 KPVGGHCALESKYVKTVCLPSDPFPSGTECHISGWGVTET-GEGSRQLLDAKVKLIANALCNSRQ 479

  Fly   201 DYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPG 261
            .|:      :.|..:|:|||.....|:|.|||||||||....:    :||:||||..|.  ..||
  Rat   480 LYD------HTIDDSMICAGNLQKPGSDTCQGDSGGPLTCEKDGTYYVYGIVSWGQECG--KKPG 536

  Fly   262 VYANVAYLRPWIDAVL---AGL 280
            ||..|.....||...:   |||
  Rat   537 VYTQVTKFLNWIKTTMHKEAGL 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/246 (34%)
Tryp_SPc 39..276 CDD:238113 85/248 (34%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056
Tryp_SPc 312..551 CDD:238113 85/248 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.