DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tmprss15

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:290 Identity:99/290 - (34%)
Similarity:142/290 - (48%) Gaps:33/290 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLLAFLVSLVALTQGLPLLE----DLDEKSVPD---GRIVGGYATDIAQVPYQISLRYKGITTPE 65
            |.|....||......|.||:    ...||.|..   .:||||..|.....|:.::|.|:    ..
  Rat   751 GSLILTPSLQCSQDSLILLQCNHKSCGEKMVTQKVGPKIVGGSDTQAGAWPWVVALYYR----DR 811

  Fly    66 NPFRHRCGGSIFNETTIVTAAHCVI--GTVASQYKVVAGTNFQTG--SDGVITNVKEIVMHEGYY 126
            :..|..||.|:.:...:|:|||||.  ....:::..|.|.:.|:.  |..|:..|.:.::...:|
  Rat   812 SGDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDRIVINPHY 876

  Fly   127 SGAAYNNDIAILFVDPPLPLNNFT--IKAIKLALEQP--IEGTVSKVSGWGTTS-PGGYSSNQLL 186
            ......||||::.::..:   |:|  |:.|.|..|..  ..|.:..::|||... ..|.:.:.|.
  Rat   877 DKRRKVNDIAMMHLEFKV---NYTDYIQPICLPEENQTFTPGRMCSIAGWGYNKINAGSTVDVLK 938

  Fly   187 AVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGV 247
            ..|||:||||.|.|...:     |.||.:|||||.. .||.|:|||||||||..::.    |.||
  Rat   939 EADVPLVSNEKCQQQLPE-----YDITESMLCAGYE-EGGTDSCQGDSGGPLMCQENNRWFLVGV 997

  Fly   248 VSWGNSCALPNYPGVYANVAYLRPWIDAVL 277
            .|:|..|||||:|||||.|:....||.:.|
  Rat   998 TSFGVQCALPNHPGVYARVSQFIEWIHSFL 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 86/247 (35%)
Tryp_SPc 39..276 CDD:238113 88/249 (35%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060
Tryp_SPc 789..1025 CDD:238113 88/248 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.