DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tmprss7

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001099352.2 Gene:Tmprss7 / 288118 RGDID:1304655 Length:829 Species:Rattus norvegicus


Alignment Length:284 Identity:88/284 - (30%)
Similarity:129/284 - (45%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DLDEKSVPDG-----------RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETT 81
            |..::|..:|           |:|||..:.....|:|:||.:.|..        .||.|:.:...
  Rat   570 DCPDRSDEEGCGCSRSSPFLHRVVGGSDSQEGTWPWQVSLHFVGSA--------HCGASVISREW 626

  Fly    82 IVTAAHCVIGTVASQ---YKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPP 143
            :::||||..|...|.   :....|...| |:...::.|:.||:|| ||:...::.|||:|.:...
  Rat   627 LLSAAHCFHGNRLSDPTPWTAHLGMYVQ-GNAKFVSPVRRIVVHE-YYNSQTFDYDIALLQLSIA 689

  Fly   144 LPLNNFTIKAIKLALEQPI----------EGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNEL 197
            .|   .|::    .|.|||          .|....|:|||.........:.:| ..:|.::...:
  Rat   690 WP---ETLR----QLIQPICIPPVGQRVRSGEKCWVTGWGRRHEADSKGSPILQQAEVELIDQTV 747

  Fly   198 CDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE------LYGVVSWGNSCAL 256
            |...|.       .|||.|||||... |.:|||:|||||||:.|.:      |.|:||||..|..
  Rat   748 CVSTYG-------IITSRMLCAGVMS-GKSDACKGDSGGPLSCRRKSDGKWILTGIVSWGYGCGR 804

  Fly   257 PNYPGVYANVAYLRPWIDAVLAGL 280
            ||:||||..|:...|||...:..|
  Rat   805 PNFPGVYTRVSNFVPWIHKYVPSL 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 82/254 (32%)
Tryp_SPc 39..276 CDD:238113 83/256 (32%)
Tmprss7NP_001099352.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..49
SEA 94..190 CDD:279699
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060 2/9 (22%)
Tryp_SPc 591..821 CDD:214473 82/254 (32%)
Tryp_SPc 592..823 CDD:238113 83/255 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.