DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss38

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:262 Identity:78/262 - (29%)
Similarity:121/262 - (46%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQ-YKVV 100
            |:::||..|...:.|:|:|:.|.|.        |.|||||.|...::|||||.......| :.:.
  Rat   112 GKLLGGELTIDRKWPWQVSIHYAGF--------HVCGGSILNAYWVLTAAHCFAREKRLQTFDMY 168

  Fly   101 AG-TNFQTGSDGVITN-------VKEIVMHEGYYSGAAYNNDI-------AILFVDPPLPL---- 146
            .| ||.:      :.|       :.::::|..:........|:       ||:|.|..||:    
  Rat   169 VGITNLE------VANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFSDYVLPICLPS 227

  Fly   147 NNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYR 211
            :|..:..:.           ...:|||..||.|.:...||...:|::....|...|   |..:| 
  Rat   228 SNLNLSDLS-----------CWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLY---GLTSY- 277

  Fly   212 ITSAMLCAGK-RGVGGADACQGDSGGPLAVR-DELY---GVVSWGNSCALPNYPGVYANVAYLRP 271
            :...|||||. :.:  .:.|:||||.||..: ::.:   |:||||..||.|.||||:|||:|...
  Rat   278 LLPEMLCAGDIKNM--KNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLN 340

  Fly   272 WI 273
            ||
  Rat   341 WI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 75/259 (29%)
Tryp_SPc 39..276 CDD:238113 77/260 (30%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 77/258 (30%)
Tryp_SPc 116..342 CDD:214473 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.