DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss34

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:288 Identity:100/288 - (34%)
Similarity:142/288 - (49%) Gaps:36/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGLLAFL-VSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRH 70
            :|:|.|| ::|..|...:||..|..::.|   .||||.....::.|:|:|||:..:..  :.:.|
  Rat     3 LGMLWFLFLTLPCLGSTMPLTPDSGQELV---GIVGGCPVSASRFPWQVSLRFYNMKL--SKWEH 62

  Fly    71 RCGGSIFNETTIVTAAHCV--IGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYS--GAAY 131
            .||||:.:...::||||||  ....||.::|..| ..:...:..:..|.:|:.|..:..  .|..
  Rat    63 ICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVG-QLRLYENDQLMKVAKIIRHPKFSEKLSAPG 126

  Fly   132 NNDIAILFVDPPLPLNNFTIKAIKL-ALEQPIEGTVSK----VSGWGTTSPGGY----SSNQLLA 187
            ..|||:|.:|..:.|:. .:..:.| |..|.|.   ||    |:|||...  |:    ....|..
  Rat   127 GADIALLKLDSTVVLSE-RVHPVSLPAASQRIS---SKKTWWVAGWGVIE--GHRPLPPPCHLRE 185

  Fly   188 VDVPIVSNELCDQDYEDFG--DETYR-ITSAMLCAGKRGVGGADACQGDSGGPLAVRDEL----Y 245
            |.||||.|..|:|.|..:.  |.|.: |...||||   |:.|.|:||.||||||..|...    .
  Rat   186 VAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCA---GMEGRDSCQADSGGPLVCRWNCSWVQV 247

  Fly   246 GVVSWGNSCALPNYPGVYANVAYLRPWI 273
            ||||||..|.||::||||..|.....||
  Rat   248 GVVSWGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 88/254 (35%)
Tryp_SPc 39..276 CDD:238113 90/255 (35%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 90/255 (35%)
Tryp_SPc 33..275 CDD:214473 88/253 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.