DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and LOC286960

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:285 Identity:91/285 - (31%)
Similarity:135/285 - (47%) Gaps:64/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGS 75
            |||.:.||    ||:.:        |.:|||||......||||:|| :.||:       |:||||
  Rat     8 AFLGAAVA----LPVND--------DDKIVGGYTCPKHLVPYQVSL-HDGIS-------HQCGGS 52

  Fly    76 IFNETTIVTAAHCVIGTVASQYK--------------VVAGTNFQTGSDGVITNVKEIVMHEGYY 126
            :.::..:::||||        ||              :..|..|        .:.::|:.|. .|
  Rat    53 LISDQWVLSAAHC--------YKRKLQVRLGEHNIHVLEGGEQF--------IDAEKIIRHP-EY 100

  Fly   127 SGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSK--VSGWG-TTSPGGYSSNQLLAV 188
            :....:|||.::.:..|..||:   :...::|.:....|.::  ||||| |.|.||.....|..:
  Rat   101 NKDTLDNDIMLIKLKSPAVLNS---QVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCL 162

  Fly   189 DVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNS 253
            :.|::|...|.:.|..      :|||.|.|.|.. .||.|:|.||||||:....|:.|:||||:.
  Rat   163 EAPVLSASSCKKSYPG------QITSNMFCLGFL-EGGKDSCDGDSGGPVVCNGEIQGIVSWGSV 220

  Fly   254 CALPNYPGVYANVAYLRPWIDAVLA 278
            ||:...||||..|.....||...:|
  Rat   221 CAMRGKPGVYTKVCNYLSWIQETMA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 80/251 (32%)
Tryp_SPc 39..276 CDD:238113 82/253 (32%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 80/251 (32%)
Tryp_SPc 24..243 CDD:238113 82/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.