DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss3b

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:273 Identity:99/273 - (36%)
Similarity:132/273 - (48%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGG 74
            ||||.:.||    |||.:|       |.:|||||......:|||:||         |...|.|||
  Rat     7 LAFLGAAVA----LPLDDD-------DDKIVGGYTCQKNSLPYQVSL---------NAGYHFCGG 51

  Fly    75 SIFNETTIVTAAHCVIGTVASQYKVVAG---TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIA 136
            |:.|...:|:||||    ..|:.:|..|   .:...|.:..|...| |:.|.. |:...::|||.
  Rat    52 SLINSQWVVSAAHC----YKSRIQVRLGEHNIDVVEGGEQFIDAAK-IIRHPS-YNANTFDNDIM 110

  Fly   137 ILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQ 200
            ::.::.|..||: .:..:.|.......||...|||||.|...|.:...|| .:|.|::|:..|..
  Rat   111 LIKLNSPATLNS-RVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKS 174

  Fly   201 DYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYAN 265
            .|..      :|||.|.|.|.. .||.|:||||||||:....:|.||||||..||....||||..
  Rat   175 SYPG------KITSNMFCLGFL-EGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTK 232

  Fly   266 VAYLRPWIDAVLA 278
            |.....||...:|
  Rat   233 VCNYVNWIQQTVA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 85/238 (36%)
Tryp_SPc 39..276 CDD:238113 87/240 (36%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 85/238 (36%)
Tryp_SPc 25..243 CDD:238113 87/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.