DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and TMPRSS12

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_872365.2 Gene:TMPRSS12 / 283471 HGNCID:28779 Length:348 Species:Homo sapiens


Alignment Length:271 Identity:80/271 - (29%)
Similarity:125/271 - (46%) Gaps:56/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KSVPDG-RIVGGYATDIAQVPYQISLRYK-GITTPENPFRHRCGGSIFNETTIVTAAHC------ 88
            |.|..| ||:||........|:.:||:.| |     ....|.|||::..|..::|||||      
Human    70 KDVLQGSRIIGGTEAQAGAWPWVVSLQIKYG-----RVLVHVCGGTLVRERWVLTAAHCTKDASD 129

  Fly    89 ------VIGT--VASQY----KVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVD 141
                  ||||  :..:|    |:               .:|.|::|..:.. .:|.||||:..:.
Human   130 PLMWTAVIGTNNIHGRYPHTKKI---------------KIKAIIIHPNFIL-ESYVNDIALFHLK 178

  Fly   142 PPLPLNNFTIKAIKLALE--QPIEG-TVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYE 203
            ..:..|:: |:.|.|..:  |.::| |...:||||.|...|.::|.|...:|..:|.|:|:.: .
Human   179 KAVRYNDY-IQPICLPFDVFQILDGNTKCFISGWGRTKEEGNATNILQDAEVHYISREMCNSE-R 241

  Fly   204 DFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAV------RDELYGVVSWGNSCALPNYPGV 262
            .:|.   .|.:...|||... |..|.|:|||||||..      |..:.|:.|:|:.|....:|||
Human   242 SYGG---IIPNTSFCAGDED-GAFDTCRGDSGGPLMCYLPEYKRFFVMGITSYGHGCGRRGFPGV 302

  Fly   263 YANVAYLRPWI 273
            |...::.:.|:
Human   303 YIGPSFYQKWL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/262 (29%)
Tryp_SPc 39..276 CDD:238113 76/263 (29%)
TMPRSS12NP_872365.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63
Tryp_SPc 78..316 CDD:238113 76/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.