DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG33459

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:311 Identity:79/311 - (25%)
Similarity:116/311 - (37%) Gaps:89/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAFLV--SLVA--LTQGLPLLEDLDEKSVP-DGRIVGGYATDIAQVPYQISLRYKGITTPENPFR 69
            :::|:  |::|  |..||.:|.:.:...:| ..||.||....:...|:...|        .|..:
  Fly     4 ISYLLVSSIIANQLLYGLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFL--------HNHLQ 60

  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITN-------VKEIVMHEGYYS 127
            ..||||:.....::||||||:.|..:....:...::....|.:...       |..|..|..|.|
  Fly    61 FLCGGSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYRS 125

  Fly   128 GAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVS------------------------- 167
            .|||  |||:                  |.|.|.:|.||:                         
  Fly   126 IAAY--DIAL------------------LKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDF 170

  Fly   168 KVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQG 232
            .::|||.|..... |..|.:.::..:....|...|....|.|:      :|||.   ..:.||.|
  Fly   171 TLTGWGATKTEPV-SQVLQSANLTQIDRGTCHDRYGHSVDHTH------ICAGS---SKSFACVG 225

  Fly   233 DSGGPLA---VRDELY-----GVVSWGNSCALPNYPG--VYANVAYLRPWI 273
            |||.|||   |.:..|     |:||.|..    |..|  |:.||.....||
  Fly   226 DSGSPLAMKVVHNRRYIHAQVGIVSRGPK----NCDGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 69/276 (25%)
Tryp_SPc 39..276 CDD:238113 70/277 (25%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 69/276 (25%)
Tryp_SPc 38..272 CDD:238113 68/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.