DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Gzma

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:280 Identity:73/280 - (26%)
Similarity:117/280 - (41%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDG---RIVGGYATDIAQVPYQISLRYKGITTPEN 66
            |:..|...:..|:                :|:|   ||:||........||.:.|:.|    |::
  Rat     8 WVSSLTTVIFLLL----------------IPEGGCERIIGGDTVVPHSRPYMVLLKLK----PDS 52

  Fly    67 PFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGT-NFQTGSDGVITNVKEIV--------MH 122
                .|.|::..:..::|||||:.|   .:.:|:.|. :.:...:..|.:||:..        .|
  Rat    53 ----ICAGALIAKNWVLTAAHCIPG---KKSEVILGAHSIKKEPEQQILSVKKAYPYPCFDKHTH 110

  Fly   123 EG------YYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS 181
            ||      ....|..|.::|||.    ||.....:|          .||...|:|||........
  Rat   111 EGDLQLLRLKKKATLNKNVAILH----LPKKGDDVK----------PGTRCHVAGWGRFHNKSPP 161

  Fly   182 SNQLLAVDVPIVSNELC-DQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELY 245
            |:.|..|::.::..::| |:.:.:|...   |...|:|||... ||.|:|.|||||||.......
  Rat   162 SDTLREVNITVIDRKICNDEKHYNFNPV---IGLNMICAGNLR-GGKDSCYGDSGGPLLCEGIFR 222

  Fly   246 GVVSWG--NSCALPNYPGVY 263
            |:.::|  ..|..|..||:|
  Rat   223 GITAFGLEGRCGDPKGPGIY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 68/244 (28%)
Tryp_SPc 39..276 CDD:238113 67/243 (28%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 68/244 (28%)
Tryp_SPc 29..256 CDD:238113 67/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.