DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tmprss5

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:251 Identity:100/251 - (39%)
Similarity:130/251 - (51%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIG---TVASQYKV 99
            |||||.|....:.|:|.|:....        ||.||.|:.....:||||||:..   :..|.::|
  Rat   207 RIVGGQAVASGRWPWQASVMLGS--------RHTCGASVLAPYWVVTAAHCMYSFRLSRLSSWRV 263

  Fly   100 VAGTNFQTG---SDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF--TIKAIKL-AL 158
            .||....:.   ..|  |.|::|:.|. .||...::.|:|:|.:..|:   ||  |:.|:.| |.
  Rat   264 HAGLVSHSAVRQHQG--TMVEKIIPHP-LYSAQNHDYDVALLQLRTPI---NFSDTVSAVCLPAK 322

  Fly   159 EQPI-EGTVSKVSGWGTTSPG-GYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGK 221
            ||.. :|:...|||||.|.|. .:||:.|....||::|.:||:......|..|:|    |||||.
  Rat   323 EQHFPQGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTDLCNSSCMYSGALTHR----MLCAGY 383

  Fly   222 RGVGGADACQGDSGGPLAVRD----ELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            .. |.||||||||||||....    .|.||||||..||.||.|||||.||....||
  Rat   384 LD-GRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 98/249 (39%)
Tryp_SPc 39..276 CDD:238113 99/250 (40%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055
Tryp_SPc 208..441 CDD:238113 99/250 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.