DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and KLK13

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:250 Identity:85/250 - (34%)
Similarity:120/250 - (48%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVA 101
            |.:.|||.......|:|.:|..:|        |..|||.:.:...::|||||    :....||..
Human    34 GFLPGGYTCFPHSQPWQAALLVQG--------RLLCGGVLVHPKWVLTAAHC----LKEGLKVYL 86

  Fly   102 GTN----FQTGSDGVITNVKEIV---MHEGYYSGAAYNN---DIAILFVDPPLPLNNFTIKAIKL 156
            |.:    .:.|.     .|:|:|   .|..|.....:.|   ||.:|.:..|:.|..: |:.:.|
Human    87 GKHALGRVEAGE-----QVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGY-IQTLPL 145

  Fly   157 ALEQPI-EGTVSKVSGWG-TTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCA 219
            :....: .||..:||||| ||||.......|...::.:.|:|.|.|.|..      :||..||||
Human   146 SHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVYPG------KITDNMLCA 204

  Fly   220 GKRGVGGADACQGDSGGPLAVRDELYGVVSWGN-SCALPNYPGVYANVAYLRPWI 273
            |.: .||.|:|:|||||||.....|||:||||: .|..|:.||||..|:....||
Human   205 GTK-EGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 82/247 (33%)
Tryp_SPc 39..276 CDD:238113 83/247 (34%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 83/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.