DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and PRSS33

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:288 Identity:102/288 - (35%)
Similarity:139/288 - (48%) Gaps:41/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLPLLEDLDEKSVPDG------RIVGGYATDIAQVPYQISLRYKGITTPENP 67
            :|..||...|.|||        .||...|      |||||......:.|:|.|::::|       
Human     9 VLLLLVLGAAGTQG--------RKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRG------- 58

  Fly    68 FRHRCGGSIFNETTIVTAAHCV-IGTVASQYKVVAGTNFQTGSDGVIT---NVKEIVMHEGYYSG 128
             .|.||||:.....::|||||. ...:.::|:|..|. .:.||....|   .|:.:::...|...
Human    59 -AHVCGGSLIAPQWVLTAAHCFPRRALPAEYRVRLGA-LRLGSTSPRTLSVPVRRVLLPPDYSED 121

  Fly   129 AAYNNDIAILFVDPPLPLNNFTIKAIKLAL--EQPIEGTVSKVSGWGTTSPGG--YSSNQLLAVD 189
            .| ..|:|:|.:..|:|| :..::.:.|.:  .:|..||..:|:|||:..||.  .....|..|.
Human   122 GA-RGDLALLQLRRPVPL-SARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVR 184

  Fly   190 VPIVSNELCDQDYEDFGD--ETYRIT-SAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGV 247
            ||::.:..||..|....|  :..||. ...|||| ...|..|||||||||||.....    |.||
Human   185 VPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAG-YPQGHKDACQGDSGGPLTCLQSGSWVLVGV 248

  Fly   248 VSWGNSCALPNYPGVYANVAYLRPWIDA 275
            ||||..|||||.||||.:||...|||.|
Human   249 VSWGKGCALPNRPGVYTSVATYSPWIQA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 89/249 (36%)
Tryp_SPc 39..276 CDD:238113 91/252 (36%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 89/249 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.