DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Plau

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:269 Identity:85/269 - (31%)
Similarity:129/269 - (47%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PDGRIVGGYATDIAQVPY--QISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIG-TVASQ 96
            |..:||||..|.:...|:  .|.|:.||.:.|.    .:||||:.:...:.:|.||.:. ....:
  Rat   175 PRFKIVGGEFTVVENQPWFAAIYLKNKGGSPPS----FKCGGSLISPCWVASATHCFVNQPKKEE 235

  Fly    97 YKVVAG----TNFQTGSDGVITNVKEIVMHEGYYSGA-AYNNDIAILFV--------DPPLPLNN 148
            |.|..|    .::..|.  :...|:::::||.:.... |::||||:|.:        .|     :
  Rat   236 YVVYLGQSKRNSYNPGE--MKFEVEQLILHEDFSDETLAFHNDIALLKIRTSTGQCAQP-----S 293

  Fly   149 FTIKAIKLAL---EQPIEGTVSKVSGWGTTSPGGYSSNQLLAVD-VPIVSNELCDQDYEDFGDET 209
            .||:.|.|..   :.|. |:..:::|:|..|...|...:.|.:. |.|:|:|.|.|.:. :|.| 
  Rat   294 RTIQTICLPPRFGDAPF-GSDCEITGFGQESATDYFYPKDLKMSVVKIISHEQCKQPHY-YGSE- 355

  Fly   210 YRITSAMLCAG----KRGVGGADACQGDSGGPLAV----RDELYGVVSWGNSCALPNYPGVYANV 266
              |...||||.    |     .|:|.|||||||..    |..|.|:||||:.||..|.||||..|
  Rat   356 --INYKMLCAADPEWK-----TDSCSGDSGGPLICNIDGRPTLSGIVSWGSGCAEKNKPGVYTRV 413

  Fly   267 AYLRPWIDA 275
            :|...||.:
  Rat   414 SYFLNWIQS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 82/262 (31%)
Tryp_SPc 39..276 CDD:238113 84/265 (32%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57
KR 67..152 CDD:238056
Connecting peptide 152..178 1/2 (50%)
Tryp_SPc 178..420 CDD:214473 82/262 (31%)
Tryp_SPc 179..423 CDD:238113 84/265 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.