DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:273 Identity:96/273 - (35%)
Similarity:132/273 - (48%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGG 74
            |.|| :||......|    :|:    |.:|||||......||||:||         |...|.|||
  Rat     4 LLFL-ALVGAAVAFP----VDD----DDKIVGGYTCQENSVPYQVSL---------NSGYHFCGG 50

  Fly    75 SIFNETTIVTAAHCVIGTVASQYKVVAG---TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIA 136
            |:.|:..:|:||||    ..|:.:|..|   .|...|::..: |..:|:.|.. :.....||||.
  Rat    51 SLINDQWVVSAAHC----YKSRIQVRLGEHNINVLEGNEQFV-NAAKIIKHPN-FDRKTLNNDIM 109

  Fly   137 ILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQ 200
            ::.:..|:.| |..:..:.|.......||...:||||.|...|.:...|| .:|.|::....|:.
  Rat   110 LIKLSSPVKL-NARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEA 173

  Fly   201 DYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYAN 265
            .|..      :||..|:|.|.. .||.|:||||||||:....||.|:||||..||||:.||||..
  Rat   174 SYPG------KITDNMVCVGFL-EGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTK 231

  Fly   266 VAYLRPWIDAVLA 278
            |.....||...:|
  Rat   232 VCNYVDWIQDTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 85/238 (36%)
Tryp_SPc 39..276 CDD:238113 87/240 (36%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 85/238 (36%)
Tryp_SPc 24..242 CDD:238113 87/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.