DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klkb1

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:275 Identity:93/275 - (33%)
Similarity:136/275 - (49%) Gaps:56/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHC- 88
            ::|..|..:..:.|||||..:.:.:.|:|:||:.|.::.     .|.|||||.....|:||||| 
  Rat   377 VVESSDCTTKINARIVGGTNSSLGEWPWQVSLQVKLVSQ-----NHMCGGSIIGRQWILTAAHCF 436

  Fly    89 ----------VIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGY-YSGAAYNNDIAILFVDP 142
                      :.|.:.:..::...|.|        :::||:::|:.| .|..:|  |||::.:..
  Rat   437 DGIPYPDVWRIYGGILNLSEITNKTPF--------SSIKELIIHQKYKMSEGSY--DIALIKLQT 491

  Fly   143 PLPLNNFTIKAIKLALEQPI-------EGTVSK---VSGWGTTSPGGYSSNQLLAVDVPIVSNEL 197
            ||   |:|      ..::||       ..|:..   |:|||.|...|.:.|.|....:|:|.||.
  Rat   492 PL---NYT------EFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEE 547

  Fly   198 CDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAV----RDELYGVVSWGNSCALPN 258
            |.:.|.|     |.||..|:|||.: .||.|||:|||||||..    |.:|.|:.|||..||...
  Rat   548 CQKKYRD-----YVITKQMICAGYK-EGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKE 606

  Fly   259 YPGVYANVAYLRPWI 273
            .||||..||....||
  Rat   607 QPGVYTKVAEYIDWI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 89/260 (34%)
Tryp_SPc 39..276 CDD:238113 90/261 (34%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 89/260 (34%)
Tryp_SPc 391..621 CDD:238113 88/259 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.