DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CELA3B

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_031378.1 Gene:CELA3B / 23436 HGNCID:15945 Length:270 Species:Homo sapiens


Alignment Length:287 Identity:80/287 - (27%)
Similarity:126/287 - (43%) Gaps:41/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCG 73
            |.:.|:..||...|.|       .|.|..|:|.|........|:|:||:|:    ....|.|.||
Human     6 LSSLLLVAVASGYGPP-------SSRPSSRVVNGEDAVPYSWPWQVSLQYE----KSGSFYHTCG 59

  Fly    74 GSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDG----VITNVKEIVMHEGY-YSGAAYNN 133
            ||:.....:|||.||:  :.:..|:||.|...:...:|    :..|..::.:|..: .|..|..|
Human    60 GSLIAPDWVVTAGHCI--SSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGN 122

  Fly   134 DIAILFVDPPLPLNNFTIKAIKLALEQPI-----EGTVSKVSGWGTTSPGGYSSNQLLAVDVPIV 193
            |||::.:.....|.:    |::||...|.     ..|...::|||.....|...::|....:|:|
Human   123 DIALIKLSRSAQLGD----AVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVV 183

  Fly   194 SNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE-----LYGVVSWGNS 253
            ..|.|.: :..:|..   :...|:|||.....|   |.|||||||....|     ::||.|:.::
Human   184 DYEHCSR-WNWWGSS---VKKTMVCAGGDIRSG---CNGDSGGPLNCPTEDGGWQVHGVTSFVSA 241

  Fly   254 --CALPNYPGVYANVAYLRPWIDAVLA 278
              |.....|.|:..|:....||:..:|
Human   242 FGCNTRRKPTVFTRVSAFIDWIEETIA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 69/251 (27%)
Tryp_SPc 39..276 CDD:238113 70/253 (28%)
CELA3BNP_031378.1 Tryp_SPc 28..263 CDD:214473 69/251 (27%)
Tryp_SPc 29..266 CDD:238113 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.