DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tmprss11d

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:284 Identity:94/284 - (33%)
Similarity:137/284 - (48%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VALTQGLPLLEDLDEKSV--------PD------GRIVGGYATDIAQVPYQISLRYKGITTPENP 67
            :|.:..:..|.|.|.::|        ||      .||:||...:....|:|:||:...:      
Mouse   150 IAPSNEITSLTDQDTENVLTQECGARPDLITLSEERIIGGMQAEPGDWPWQVSLQLNNV------ 208

  Fly    68 FRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVIT-------NVKEIVMHEGY 125
              |.|||::.:...::|||||        :|......:.|.:.||.|       .|:.|:.|:| 
Mouse   209 --HHCGGALISNMWVLTAAHC--------FKSYPNPQYWTATFGVSTMSPRLRVRVRAILAHDG- 262

  Fly   126 YSGAAYNNDIAILFVDPPLPLN-NFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVD 189
            ||....:||||::.:|..:..: |.....:..|.:..|.|:|:.|:|||:.:.||.:...|...:
Mouse   263 YSSVTRDNDIAVVQLDRSVAFSRNIHRVCLPAATQNIIPGSVAYVTGWGSLTYGGNAVTNLRQGE 327

  Fly   190 VPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE-----LYGVVS 249
            |.|:|:|.|:......|.    :...|||||.|. |..|||||||||||...|.     :.|:||
Mouse   328 VRIISSEECNTPAGYSGS----VLPGMLCAGMRS-GAVDACQGDSGGPLVQEDSRRLWFVVGIVS 387

  Fly   250 WGNSCALPNYPGVYANVAYLRPWI 273
            ||..|.|||.||||..|...|.||
Mouse   388 WGYQCGLPNKPGVYTRVTAYRNWI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 85/247 (34%)
Tryp_SPc 39..276 CDD:238113 86/248 (35%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699
Tryp_SPc 185..411 CDD:214473 85/247 (34%)
Tryp_SPc 186..414 CDD:238113 86/248 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.