DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:272 Identity:94/272 - (34%)
Similarity:135/272 - (49%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIF 77
            :::||......|    :|:    |.:|||||....:.||||:||         |...|.||||:.
Mouse     6 ILALVGAAVAFP----VDD----DDKIVGGYTCRESSVPYQVSL---------NAGYHFCGGSLI 53

  Fly    78 NETTIVTAAHCVIGTVASQYKVVA-----GTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAI 137
            |:..:|:||||.      :|::..     ..|...|::..:.:.| |:.|..|.|. ..:|||.:
Mouse    54 NDQWVVSAAHCY------KYRIQVRLGEHNINVLEGNEQFVDSAK-IIRHPNYNSW-TLDNDIML 110

  Fly   138 LFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQD 201
            :.:..|:.| |..:.::.|.......||...:||||.|...|.::..|| .||.|::....|:..
Mouse   111 IKLASPVTL-NARVASVPLPSSCAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLPQADCEAS 174

  Fly   202 YEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANV 266
            |.  ||    ||:.|:|.|.. .||.|:||||||||:....||.|:||||..||.|:.||||..|
Mouse   175 YP--GD----ITNNMICVGFL-EGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQPDAPGVYTKV 232

  Fly   267 AYLRPWIDAVLA 278
            .....||...:|
Mouse   233 CNYVDWIQNTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 86/240 (36%)
Tryp_SPc 39..276 CDD:238113 88/242 (36%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 86/240 (36%)
Tryp_SPc 24..242 CDD:238113 88/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.