DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss38

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:276 Identity:79/276 - (28%)
Similarity:123/276 - (44%) Gaps:63/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLPLLEDLDEKSVPDGRIVGG-YATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTA 85
            |.|:|:         |:::|| :|.| .:.|:|:||.|.|.        |.|||||.:...:::|
Mouse    48 GQPVLQ---------GKLLGGEFARD-RKWPWQVSLHYSGF--------HICGGSILSAYWVLSA 94

  Fly    86 AHCV-IGTVASQYKVVAGTNFQTGSDGVITNVK------------EIVMHEGYYSGAAYNNDIAI 137
            |||. .|.....|.:..|          |||::            ::::|..:........|:|:
Mouse    95 AHCFDRGKKLETYDIYVG----------ITNLEKANRHTQWFEIYQVIIHPTFQMYHPIGGDVAL 149

  Fly   138 LFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDY 202
            :.:...:..::|.:.......:..:.......:|||..||.|.:.|:||...:|::....|...|
Mouse   150 VQLKSAIVFSDFVLPICLPPSDLYLINLSCWTTGWGMISPQGETGNELLEAQLPLIPRFQCQLLY 214

  Fly   203 EDFGDETYRITSAMLCAGKRGVGGAD------ACQGDSGGPLAVRDE----LYGVVSWGNSCALP 257
               |..:| :...||||       ||      .|:||||.||..:..    ..|:||||..||.|
Mouse   215 ---GLSSY-LLPEMLCA-------ADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCAQP 268

  Fly   258 NYPGVYANVAYLRPWI 273
            .||||:|||:|...||
Mouse   269 LYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 73/258 (28%)
Tryp_SPc 39..276 CDD:238113 75/259 (29%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 75/257 (29%)
Tryp_SPc 58..284 CDD:214473 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.