DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and F12

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_000496.2 Gene:F12 / 2161 HGNCID:3530 Length:615 Species:Homo sapiens


Alignment Length:263 Identity:86/263 - (32%)
Similarity:116/263 - (44%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQ-YKVVA 101
            |:|||........|| |:..|.|     :.|   |.||:.....::|||||:....|.: ..||.
Human   372 RVVGGLVALRGAHPY-IAALYWG-----HSF---CAGSLIAPCWVLTAAHCLQDRPAPEDLTVVL 427

  Fly   102 GTNFQTGSDGVITN--VKEIVMHEGYYSGAAYNNDIAIL---------------FVDPPLPLNNF 149
            |...:..|......  |:...:||. :|..:|.:|:|:|               :|.|       
Human   428 GQERRNHSCEPCQTLAVRSYRLHEA-FSPVSYQHDLALLRLQEDADGSCALLSPYVQP------- 484

  Fly   150 TIKAIKLALEQPIEGTVSKVSGWGTTSPGG--YSSNQLLAVDVPIVSNELCDQDYEDFGDETYRI 212
              ..:.....:|.|.|:.:|:|||....|.  |:| .|....||.:|.|.|... :..|..   |
Human   485 --VCLPSGAARPSETTLCQVAGWGHQFEGAEEYAS-FLQEAQVPFLSLERCSAP-DVHGSS---I 542

  Fly   213 TSAMLCAGKRGVGGADACQGDSGGPLAVRDE-------LYGVVSWGNSCALPNYPGVYANVAYLR 270
            ...|||||.. .||.|||||||||||...|:       |.|::|||:.|...|.||||.:|||..
Human   543 LPGMLCAGFL-EGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYL 606

  Fly   271 PWI 273
            .||
Human   607 AWI 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/261 (32%)
Tryp_SPc 39..276 CDD:238113 85/262 (32%)
F12NP_000496.2 FN2 41..88 CDD:128373
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
Kringle 217..295 CDD:278480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359
Tryp_SPc 372..609 CDD:214473 84/261 (32%)
Tryp_SPc 373..612 CDD:238113 85/262 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.