DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and PRSS55

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:305 Identity:90/305 - (29%)
Similarity:139/305 - (45%) Gaps:56/305 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQ----------GLPLL------------------EDLDEKSVPDG-----RIVGGYA 44
            |:|||..||          |:.:|                  .:..::|:.:|     ||.||..
Human     9 LLSLVTGTQLGPRTPLPEAGVAILGRARGAHRPQPPHPPSPVSECGDRSIFEGRTRYSRITGGME 73

  Fly    45 TDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIG--TVASQYKVVAGTNFQT 107
            .::.:.|:|:|::.:     ..||   |||||.|:..|:|||||:..  ....:..||.|||..|
Human    74 AEVGEFPWQVSIQAR-----SEPF---CGGSILNKWWILTAAHCLYSEELFPEELSVVLGTNDLT 130

  Fly   108 GSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGW 172
            .....|..|..|::|:. :..|..:||||:|.:..|:.|::..:.........|.......|:||
Human   131 SPSMEIKEVASIILHKD-FKRANMDNDIALLLLASPIKLDDLKVPICLPTQPGPATWRECWVAGW 194

  Fly   173 GTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGP 237
            |.|:....:|.:...:..|:|.     .|:|:......::|..|||||.:. ...|||:||||||
Human   195 GQTNAADKNSVKTDLMKAPMVI-----MDWEECSKMFPKLTKNMLCAGYKN-ESYDACKGDSGGP 253

  Fly   238 LAVRDE------LYGVVSWGNSCALPNYPGVYANVAYLRPWIDAV 276
            |....|      ..|::|||.||...|.||:|.::.....||:.|
Human   254 LVCTPEPGEKWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWIEKV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 77/242 (32%)
Tryp_SPc 39..276 CDD:238113 78/244 (32%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 77/242 (32%)
Tryp_SPc 68..298 CDD:238113 78/244 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.