DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and ELANE

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001963.1 Gene:ELANE / 1991 HGNCID:3309 Length:267 Species:Homo sapiens


Alignment Length:248 Identity:64/248 - (25%)
Similarity:102/248 - (41%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGT 103
            ||||........|:.:||:.:|        .|.||.::.....:::|||||........:||.|.
Human    30 IVGGRRARPHAWPFMVSLQLRG--------GHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGA 86

  Fly   104 NFQTGSDGV--ITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIE--- 163
            :..:..:..  :..|:.|  .|..|......|||.||.::     .:.||.|.....:.|.:   
Human    87 HNLSRREPTRQVFAVQRI--FENGYDPVNLLNDIVILQLN-----GSATINANVQVAQLPAQGRR 144

  Fly   164 ---GTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVG 225
               |......|||........::.|..::|.:|:: ||.:              :.:|...|| .
Human   145 LGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTS-LCRR--------------SNVCTLVRG-R 193

  Fly   226 GADACQGDSGGPLAVRDELYGVVSW-GNSCALPNYPGVYANVAYLRPWIDAVL 277
            .|..|.||||.||.....::|:.|: ...||...||..:|.||....|||:::
Human   194 QAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSII 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 61/242 (25%)
Tryp_SPc 39..276 CDD:238113 64/245 (26%)
ELANENP_001963.1 Tryp_SPc 30..245 CDD:238113 64/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.