DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prtn3

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:274 Identity:72/274 - (26%)
Similarity:108/274 - (39%) Gaps:34/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRC 72
            |:..||  |:||..|         .:|...:||||:.......||..||:....     |..|.|
Mouse    10 GIHPFL--LLALVVG---------GAVQASKIVGGHEARPHSRPYVASLQLSRF-----PGSHFC 58

  Fly    73 GGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAI 137
            ||::.:...::|||||:.........||.|.:....|:..........:.:..|:.....||:.:
Mouse    59 GGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLL 123

  Fly   138 LFVDPPLPLNNFTIKAIKLALEQPI-EGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQD 201
            |.::....|......|.....:|.: :||.....|||.......:...|..::|.:|: .||   
Mouse   124 LQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVT-FLC--- 184

  Fly   202 YEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWG-NSCALPNYPGVYAN 265
                     |..:......:|..|   .|.|||||||.....|:||.|:. ..||...:|..:|.
Mouse   185 ---------REHNVCTLVPRRAAG---ICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFAR 237

  Fly   266 VAYLRPWIDAVLAG 279
            |:....||..||.|
Mouse   238 VSMYVDWIQNVLRG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 59/236 (25%)
Tryp_SPc 39..276 CDD:238113 61/238 (26%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 59/236 (25%)
Tryp_SPc 30..248 CDD:238113 61/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.