DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Proc

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:275 Identity:83/275 - (30%)
Similarity:128/275 - (46%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGT 92
            ||:::..||.|||.|..|.....|:|..|.       ::..:..|||.:.:.:.::||||||.||
Mouse   225 DLEDELEPDPRIVNGTLTKQGDSPWQAILL-------DSKKKLACGGVLIHTSWVLTAAHCVEGT 282

  Fly    93 V-----ASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIK 152
            .     ..:|.:....:::...|     :|||::|.. |:.::.:||||:|.:..|..|:. ||.
Mouse   283 KKLTVRLGEYDLRRRDHWELDLD-----IKEILVHPN-YTRSSSDNDIALLRLAQPATLSK-TIV 340

  Fly   153 AI-----KLALEQPIEGTVSKVSGWGTTSPGGYSSNQ-----------LLAVDVPIVSNELCDQD 201
            .|     .||.|....|..:.|:||      ||.|::           |..:.:|:|:...|.:.
Mouse   341 PICLPNNGLAQELTQAGQETVVTGW------GYQSDRIKDGRRNRTFILTFIRIPLVARNECVEV 399

  Fly   202 YEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPGV 262
            .::.      ::..|||||..| ...|||.||||||:.|...    |.|:||||..|...|..|:
Mouse   400 MKNV------VSENMLCAGIIG-DTRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHTNNYGI 457

  Fly   263 YANVAYLRPWIDAVL 277
            |..|.....||.:.:
Mouse   458 YTKVGSYLKWIHSYI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 77/259 (30%)
Tryp_SPc 39..276 CDD:238113 78/261 (30%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011
FXa_inhibition 163..198 CDD:373209
Tryp_SPc 236..470 CDD:238113 78/260 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.