DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tpsb2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:292 Identity:101/292 - (34%)
Similarity:139/292 - (47%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGR-----IVGGYATDIAQVPYQISLRYKGITTP 64
            |.:.|||.||                 .|.|...     ||||:....::.|:|:|||:|     
Mouse    10 WALSLLASLV-----------------YSAPRPANQRVGIVGGHEASESKWPWQVSLRFK----- 52

  Fly    65 ENPFRHRCGGSIFNETTIVTAAHCVIGTVASQ--YKVVAGTNFQTGSDGVITNVKEIVMHEGYYS 127
            .|.:.|.||||:.:...::||||||...:.|.  ::|.....:....|.:: ::..||:|..||:
Mouse    53 LNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLL-SLNRIVVHPHYYT 116

  Fly   128 --GAAYNNDIAILFVDPPLPLNNFTIKAIKL--ALEQPIEGTVSKVSGWGTTS-----PGGYSSN 183
              |.|   |:|:|.::.|:.::.. :..|.|  |.|....||...|:|||...     |..|...
Mouse   117 AEGGA---DVALLELEVPVNVSTH-LHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLK 177

  Fly   184 QLLAVDVPIVSNELCDQDYED---FGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE-- 243
            |   |.||||.|.|||:.|..   .||:...:...|||||..   ..|:|||||||||..:.:  
Mouse   178 Q---VKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNT---RRDSCQGDSGGPLVCKVKGT 236

  Fly   244 --LYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
              ..||||||..||.||.||:|..|.|...||
Mouse   237 WLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 91/257 (35%)
Tryp_SPc 39..276 CDD:238113 93/253 (37%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 93/253 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.