DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Hpn

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001263198.1 Gene:Hpn / 15451 MGIID:1196620 Length:445 Species:Mus musculus


Alignment Length:265 Identity:98/265 - (36%)
Similarity:138/265 - (52%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV-- 89
            :|...:.:|..|||||..:.:.:.|:|:||||.|        .|.||||:.:...::|||||.  
Mouse   179 QDCGRRKLPVDRIVGGQDSSLGRWPWQVSLRYDG--------THLCGGSLLSGDWVLTAAHCFPE 235

  Fly    90 IGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYY-----SGAAYNNDIAILFVDPPLPLNNF 149
            ...|.|:::|.||...:|....|...|:.::.|.||.     :....:||||::.:...|||..:
Mouse   236 RNRVLSRWRVFAGAVARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEY 300

  Fly   150 TIKAIKL--ALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQ-DYEDFGDETYR 211
             |:.:.|  |.:..::|.|..|:|||.|...|..:..|....|||:|||:|:. |:  :|::   
Mouse   301 -IQPVCLPAAGQALVDGKVCTVTGWGNTQFYGQQAMVLQEARVPIISNEVCNSPDF--YGNQ--- 359

  Fly   212 ITSAMLCAGKRGVGGADACQGDSGGPLAVRD--------ELYGVVSWGNSCALPNYPGVYANVAY 268
            |...|.||| ...||.||||||||||....|        .|.|:||||..|||...||||..|..
Mouse   360 IKPKMFCAG-YPEGGIDACQGDSGGPFVCEDSISGTSRWRLCGIVSWGTGCALARKPGVYTKVTD 423

  Fly   269 LRPWI 273
            .|.||
Mouse   424 FREWI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 94/252 (37%)
Tryp_SPc 39..276 CDD:238113 95/253 (38%)
HpnNP_001263198.1 Hepsin-SRCR 78..187 CDD:255261 1/7 (14%)
Tryp_SPc 190..428 CDD:214473 94/252 (37%)
Tryp_SPc 191..428 CDD:238113 93/251 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11737
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.