DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Egfbp2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:276 Identity:82/276 - (29%)
Similarity:127/276 - (46%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSI 76
            ||:..:||:.|     .:|.......|:|||:.......|:|:::.|:.        .|.|||.:
Mouse     3 FLILFLALSLG-----GIDAAPPLQSRVVGGFNCKKNSQPWQVAVYYQK--------EHICGGVL 54

  Fly    77 FNETTIVTAAHCVIGTVASQYKVVAGTN--FQTGSDGVITNVKEIVMHEGYY----------SGA 129
            .:...::|||||.:    .||:|..|.|  ||.........|.:...|.|:.          .||
Mouse    55 LDRNWVLTAAHCYV----DQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGA 115

  Fly   130 AYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSS-NQLLAVDVPIV 193
            .::||:.:|.:..|..:.: .:|.|.|..::|..|:....||||:.:|..:.. :.|..|.:.::
Mouse   116 DFSNDLMLLRLSKPADITD-VVKPIALPTKEPKPGSKCLASGWGSITPTRWQKPDDLQCVFITLL 179

  Fly   194 SNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGN-SCALP 257
            .||.|.:.|      ..::|..|||||:.| ||.|.|:.||||||.....|.|..|:|. .|..|
Mouse   180 PNENCAKVY------LQKVTDVMLCAGEMG-GGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKP 237

  Fly   258 NYPGVYANVAYLRPWI 273
            ..|.:|.|:.....||
Mouse   238 GVPAIYTNLIKFNSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 74/248 (30%)
Tryp_SPc 39..276 CDD:238113 75/249 (30%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 74/248 (30%)
Tryp_SPc 25..256 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.