DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:257 Identity:87/257 - (33%)
Similarity:124/257 - (48%) Gaps:43/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYK 98
            :...:||.|.::.....|:|.|:::||        ||.||.|:.:...:::||||......|:..
Human   180 ITGNKIVNGKSSLEGAWPWQASMQWKG--------RHYCGASLISSRWLLSAAHCFAKKNNSKDW 236

  Fly    99 VVAGTNFQTGSDGVITN-------VKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKL 156
            .|   ||     |::.|       |:.|:.||. ||....::|||::.:...:   :||....|:
Human   237 TV---NF-----GIVVNKPYMTRKVQNIIFHEN-YSSPGLHDDIALVQLAEEV---SFTEYIRKI 289

  Fly   157 ALEQP----IEGTVSKVSGWGTTSPGGYSSNQLLAVD-VPIVSNELCDQDYEDFGDETYRITSAM 216
            .|.:.    .|.....|:||||....| |...:|..| :.|:.|::|:..|...|    .:|..|
Human   290 CLPEAKMKLSENDNVVVTGWGTLYMNG-SFPVILQEDFLKIIDNKICNASYAYSG----FVTDTM 349

  Fly   217 LCAGKRGVGGADACQGDSGGPLAVRD-----ELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            ||||... |.|||||.|||||||..|     .|.|:||||:.|...|.||||..|...|.||
Human   350 LCAGFMS-GEADACQNDSGGPLAYPDSRNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 85/251 (34%)
Tryp_SPc 39..276 CDD:238113 87/252 (35%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699
Tryp_SPc 184..410 CDD:214473 85/251 (34%)
Tryp_SPc 185..413 CDD:238113 87/252 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.