DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP001198

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_321961.2 Gene:AgaP_AGAP001198 / 1281971 VectorBaseID:AGAP001198 Length:260 Species:Anopheles gambiae


Alignment Length:289 Identity:88/289 - (30%)
Similarity:134/289 - (46%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAFLV--SLVALTQGL--PLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRH 70
            |||::  :|:||...:  |::|              |...::.:.|||:||::.  ....:..||
Mosquito     4 LAFIIIPALIALGHSIRPPIIE--------------GTEANLHEFPYQVSLQWN--FNNGSRARH 52

  Fly    71 RCGGSIFNETTIVTAAHCVIG-TVASQYKVVAGTN----FQTGSDGVITNVKEIVMHEGYYSGAA 130
            .|.|||.|:..|:|||||:.. |....::||||.|    .:.|:..  .||.....||. |..:|
Mosquito    53 FCSGSIINQRWILTAAHCLEEYTKDGWFEVVAGVNNIAHEEAGAQR--RNVTRYEQHES-YDLSA 114

  Fly   131 YNNDIAILFVDPPLPLNNFTIKAIKLALEQP-IEGTVSKVSGWGTTS-------PGGYSSNQLLA 187
            ...||.:|.:..||.|.. .||.::||.:.. |...::|.:|||:.|       |     ::|:.
Mosquito   115 IRYDIGVLQLSHPLDLTR-NIKTMRLATKDTLIHQKIAKFAGWGSISKTWEDIYP-----DKLMK 173

  Fly   188 VDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAV----RDELYGVV 248
            |::.:.:.|.|    :..|    :|....:|||  |......|..||||||.|    .....||:
Mosquito   174 VNLILRTEEDC----QTIG----KIDETQICAG--GYKNVSGCTADSGGPLTVTIDGEQMQIGVL 228

  Fly   249 SWGNSCALPNYPGVYANVAYLRPWI-DAV 276
            |:|........|.||::|.|...|| ||:
Mosquito   229 SYGEKPCQARLPIVYSSVMYFHDWIQDAI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/251 (30%)
Tryp_SPc 39..276 CDD:238113 79/254 (31%)
AgaP_AGAP001198XP_321961.2 Tryp_SPc 23..255 CDD:238113 79/266 (30%)
Tryp_SPc 23..253 CDD:214473 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.