DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CLIPA4

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_552464.1 Gene:CLIPA4 / 1280862 VectorBaseID:AGAP011780 Length:422 Species:Anopheles gambiae


Alignment Length:270 Identity:77/270 - (28%)
Similarity:119/270 - (44%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGRIVGGYATD--IAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYK 98
            |..:.|.:..:  ..:.|:.:::    |.|.:.  ...||||:.:...::|.||||.|....|.|
Mosquito   152 DFTLTGNFNNEAGFGEFPWTVAI----IKTQDG--SSTCGGSLIHPNLVLTGAHCVQGFRKGQLK 210

  Fly    99 VVAGT-NFQTGSDGV------ITNVKEIVMHEGYYSGAAYNNDIAILFVDPPL-PLNNFTIKAIK 155
            |.||. :.||..:.:      :|.|..   |.. ::..:..||||:|.:|.|: |..:..:..: 
Mosquito   211 VRAGEWDTQTTKERLPYQERAVTRVNS---HPD-FNPRSLANDIAVLELDSPIQPAEHINVVCL- 270

  Fly   156 LALEQPIEGTVSK----VSGWGTTSPG--GYSSNQLLAVDVPIVSNELCDQDYEDFG-DETYRIT 213
                .|:.....:    .||||....|  |..|..:..|.:|:|.:..|::..:... ...:|:.
Mosquito   271 ----PPVNFDTRRTDCFASGWGKDQFGKAGRYSVIMKKVPLPLVPSSTCERQLQATRLTSRFRLH 331

  Fly   214 SAMLCAGKRGVGGADACQGDSGGPL-----AVRDELY---GVVSWGNSCALPNYPGVYANVAYLR 270
            ...:|||  |..|.|.|:||.|.||     |..:..|   |.|:||..|. ...||||.||...|
Mosquito   332 QTFICAG--GERGVDTCEGDGGAPLVCPIGAASENRYAQVGSVAWGIGCH-DAVPGVYTNVILFR 393

  Fly   271 PWIDAVLAGL 280
            .|||.|:..|
Mosquito   394 SWIDNVVRTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 71/259 (27%)
Tryp_SPc 39..276 CDD:238113 74/261 (28%)
CLIPA4XP_552464.1 Tryp_SPc 161..399 CDD:238113 73/255 (29%)
Tryp_SPc 161..396 CDD:214473 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.