DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CLIPA5

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_320729.4 Gene:CLIPA5 / 1280861 VectorBaseID:AGAP011787 Length:397 Species:Anopheles gambiae


Alignment Length:236 Identity:74/236 - (31%)
Similarity:108/236 - (45%) Gaps:45/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVI-----TNVKEIVMHEGYYSGA 129
            ::||||:.....::||||||.....:|..:.|| .:.|.::..:     ..|.|:::||. :...
Mosquito   163 YQCGGSVIAPNVVLTAAHCVFNKPKTQLLLRAG-EWDTQTEHELYMHQNRRVAEVILHEA-FDNE 225

  Fly   130 AYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSK-----VSGWGTTSPGGYSSNQLL--A 187
            :..||:|:|.:..|..|.. .::.|.|    |..||...     .||||....|.....|::  .
Mosquito   226 SLANDVALLTLAEPFQLGE-NVQPICL----PPSGTSFDYQHCFASGWGKDQFGKEGKYQVILKK 285

  Fly   188 VDVPIVSNELCDQDYEDFGDETYR---------ITSAMLCAGKRGVGGADACQGDSGGPLAV--- 240
            |::|:|.:..|        .||.|         :..:.||||  ||.|.|.|:||.|.||..   
Mosquito   286 VELPVVPHAKC--------QETMRSQRVGNWFVLDQSFLCAG--GVAGQDMCRGDGGSPLVCPIP 340

  Fly   241 --RDELY--GVVSWGNSCALPNYPGVYANVAYLRPWIDAVL 277
              ....|  |:|:||..|.....||||.:||:||.|||..|
Mosquito   341 GSPTHYYQAGIVAWGLGCGEDGIPGVYGDVAFLRDWIDQQL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 70/230 (30%)
Tryp_SPc 39..276 CDD:238113 73/233 (31%)
CLIPA5XP_320729.4 Tryp_SPc 135..380 CDD:238113 73/233 (31%)
Tryp_SPc 135..377 CDD:214473 70/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.